Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins) |
Protein Bacteriorhodopsin [56871] (3 species) a light-driven proton pump |
Species Halobacterium sp. [TaxId:64091] [346420] (7 PDB entries) |
Domain d3t45c_: 3t45 C: [249776] automated match to d1r84a_ complexed with li1, ret; mutant |
PDB Entry: 3t45 (more details), 3.01 Å
SCOPe Domain Sequences for d3t45c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t45c_ f.13.1.1 (C:) Bacteriorhodopsin {Halobacterium sp. [TaxId: 64091]} rpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygl tmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvga ltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsayp vvwligsegagivplnietllfmvldvstkvgfglillrsraifg
Timeline for d3t45c_: