Lineage for d3t2qb5 (3t2q B:731-1023)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2782125Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2782126Protein automated matches [226849] (8 species)
    not a true protein
  7. 2782136Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries)
  8. 2782194Domain d3t2qb5: 3t2q B:731-1023 [249755]
    Other proteins in same PDB: d3t2qa1, d3t2qa2, d3t2qa3, d3t2qa4, d3t2qb1, d3t2qb2, d3t2qb3, d3t2qb4, d3t2qc1, d3t2qc2, d3t2qc3, d3t2qc4, d3t2qd1, d3t2qd2, d3t2qd3, d3t2qd4
    automated match to d1jz8a4
    complexed with 149, dms, mg, na

Details for d3t2qb5

PDB Entry: 3t2q (more details), 2.4 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796d) in complex with galactonolactone
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3t2qb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2qb5 b.30.5.0 (B:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvdeatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3t2qb5:

Click to download the PDB-style file with coordinates for d3t2qb5.
(The format of our PDB-style files is described here.)

Timeline for d3t2qb5: