SCOPe 2.05: Domain d3t2qa3: 3t2q A:334-625

Lineage for d3t2qa3 (3t2q A:334-625)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)

8. Domain d3t2qa3: 3t2q A:334-625 [249748]
   Other proteins in same PDB: d3t2qa1, d3t2qa2, d3t2qa4, d3t2qa5, d3t2qb1, d3t2qb2, d3t2qb4, d3t2qb5, d3t2qc1, d3t2qc2, d3t2qc4, d3t2qc5, d3t2qd1, d3t2qd2, d3t2qd4, d3t2qd5
   automated match to d1jz7a5
   complexed with 149, dms, mg, na

Details for d3t2qa3

PDB Entry: 3t2q, 2.4 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796d) in complex with galactonolactone

PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3t2qa3:

Sequence; same for both SEQRES and ATOM records:

>d3t2qa3 c.1.8.0 (A:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

Timeline for d3t2qa3:

• d3t2qa3 first appeared in SCOPe 2.04
  
• d3t2qa3 appears in SCOPe 2.06
  
• d3t2qa3 appears in the current release, SCOPe 2.08