Lineage for d3t2pd4 (3t2p D:626-730)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521823Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1522274Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 1522275Protein automated matches [254633] (4 species)
    not a true protein
  7. 1522351Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries)
  8. 1522487Domain d3t2pd4: 3t2p D:626-730 [249744]
    Other proteins in same PDB: d3t2pa1, d3t2pa3, d3t2pa5, d3t2pb1, d3t2pb3, d3t2pb5, d3t2pc1, d3t2pc3, d3t2pc5, d3t2pd1, d3t2pd3, d3t2pd5
    automated match to d1jz8a2
    complexed with dms, ipt, mg, na

Details for d3t2pd4

PDB Entry: 3t2p (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796d) in complex with iptg
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3t2pd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2pd4 b.1.4.0 (D:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d3t2pd4:

Click to download the PDB-style file with coordinates for d3t2pd4.
(The format of our PDB-style files is described here.)

Timeline for d3t2pd4: