Lineage for d3t2pc1 (3t2p C:9-219)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2047120Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2047121Protein automated matches [190770] (37 species)
    not a true protein
  7. 2047214Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 2047281Domain d3t2pc1: 3t2p C:9-219 [249736]
    Other proteins in same PDB: d3t2pa2, d3t2pa3, d3t2pa4, d3t2pa5, d3t2pb2, d3t2pb3, d3t2pb4, d3t2pb5, d3t2pc2, d3t2pc3, d3t2pc4, d3t2pc5, d3t2pd2, d3t2pd3, d3t2pd4, d3t2pd5
    automated match to d1f49a3
    complexed with dms, ipt, mg, na

Details for d3t2pc1

PDB Entry: 3t2p (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796d) in complex with iptg
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3t2pc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2pc1 b.18.1.0 (C:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3t2pc1:

Click to download the PDB-style file with coordinates for d3t2pc1.
(The format of our PDB-style files is described here.)

Timeline for d3t2pc1: