Lineage for d3t2pa3 (3t2p A:334-625)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820392Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 1820461Domain d3t2pa3: 3t2p A:334-625 [249728]
    Other proteins in same PDB: d3t2pa1, d3t2pa2, d3t2pa4, d3t2pa5, d3t2pb1, d3t2pb2, d3t2pb4, d3t2pb5, d3t2pc1, d3t2pc2, d3t2pc4, d3t2pc5, d3t2pd1, d3t2pd2, d3t2pd4, d3t2pd5
    automated match to d1jz7a5
    complexed with dms, ipt, mg, na

Details for d3t2pa3

PDB Entry: 3t2p (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796d) in complex with iptg
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3t2pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2pa3 c.1.8.0 (A:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3t2pa3:

Click to download the PDB-style file with coordinates for d3t2pa3.
(The format of our PDB-style files is described here.)

Timeline for d3t2pa3: