Lineage for d3chbe_ (3chb E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59002Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 59003Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 59004Protein Cholera toxin [50208] (1 species)
  7. 59005Species Vibrio cholerae [TaxId:666] [50209] (9 PDB entries)
  8. 59007Domain d3chbe_: 3chb E: [24971]

Details for d3chbe_

PDB Entry: 3chb (more details), 1.25 Å

PDB Description: cholera toxin b-pentamer complexed with gm1 pentasaccharide

SCOP Domain Sequences for d3chbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3chbe_ b.40.2.1 (E:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktpraiaaisman

SCOP Domain Coordinates for d3chbe_:

Click to download the PDB-style file with coordinates for d3chbe_.
(The format of our PDB-style files is described here.)

Timeline for d3chbe_: