Lineage for d3t0dd3 (3t0d D:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832572Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 2832588Domain d3t0dd3: 3t0d D:334-625 [249697]
    Other proteins in same PDB: d3t0da1, d3t0da2, d3t0da4, d3t0da5, d3t0db1, d3t0db2, d3t0db4, d3t0db5, d3t0dc1, d3t0dc2, d3t0dc4, d3t0dc5, d3t0dd1, d3t0dd2, d3t0dd4, d3t0dd5
    automated match to d1jz7a5
    complexed with 149, dms, mg, na

Details for d3t0dd3

PDB Entry: 3t0d (more details), 1.93 Å

PDB Description: e.coli (lacz) beta-galactosidase (s796t) in complex with galactonolactone
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3t0dd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t0dd3 c.1.8.0 (D:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3t0dd3:

Click to download the PDB-style file with coordinates for d3t0dd3.
(The format of our PDB-style files is described here.)

Timeline for d3t0dd3: