Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (4 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
Domain d3t0dd2: 3t0d D:220-333 [249696] Other proteins in same PDB: d3t0da1, d3t0da3, d3t0da5, d3t0db1, d3t0db3, d3t0db5, d3t0dc1, d3t0dc3, d3t0dc5, d3t0dd1, d3t0dd3, d3t0dd5 automated match to d1jz8a1 complexed with 149, dms, mg, na |
PDB Entry: 3t0d (more details), 1.93 Å
SCOPe Domain Sequences for d3t0dd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t0dd2 b.1.4.0 (D:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3t0dd2:
View in 3D Domains from same chain: (mouse over for more information) d3t0dd1, d3t0dd3, d3t0dd4, d3t0dd5 |