Lineage for d3t0dc5 (3t0d C:731-1023)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782204Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1782343Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1782802Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 1782803Protein automated matches [226849] (5 species)
    not a true protein
  7. 1782813Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries)
  8. 1782836Domain d3t0dc5: 3t0d C:731-1023 [249694]
    Other proteins in same PDB: d3t0da1, d3t0da2, d3t0da3, d3t0da4, d3t0db1, d3t0db2, d3t0db3, d3t0db4, d3t0dc1, d3t0dc2, d3t0dc3, d3t0dc4, d3t0dd1, d3t0dd2, d3t0dd3, d3t0dd4
    automated match to d1jz8a4
    complexed with 149, dms, mg, na

Details for d3t0dc5

PDB Entry: 3t0d (more details), 1.93 Å

PDB Description: e.coli (lacz) beta-galactosidase (s796t) in complex with galactonolactone
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3t0dc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t0dc5 b.30.5.0 (C:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvteatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3t0dc5:

Click to download the PDB-style file with coordinates for d3t0dc5.
(The format of our PDB-style files is described here.)

Timeline for d3t0dc5: