Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (37 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
Domain d3t0bc1: 3t0b C:9-219 [249670] Other proteins in same PDB: d3t0ba2, d3t0ba3, d3t0ba4, d3t0ba5, d3t0bb2, d3t0bb3, d3t0bb4, d3t0bb5, d3t0bc2, d3t0bc3, d3t0bc4, d3t0bc5, d3t0bd2, d3t0bd3, d3t0bd4, d3t0bd5 automated match to d1f49a3 complexed with dms, ipt, mg, na |
PDB Entry: 3t0b (more details), 2.4 Å
SCOPe Domain Sequences for d3t0bc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t0bc1 b.18.1.0 (C:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]} vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3t0bc1:
View in 3D Domains from same chain: (mouse over for more information) d3t0bc2, d3t0bc3, d3t0bc4, d3t0bc5 |