Lineage for d3t0bc1 (3t0b C:9-219)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2047120Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2047121Protein automated matches [190770] (37 species)
    not a true protein
  7. 2047214Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 2047269Domain d3t0bc1: 3t0b C:9-219 [249670]
    Other proteins in same PDB: d3t0ba2, d3t0ba3, d3t0ba4, d3t0ba5, d3t0bb2, d3t0bb3, d3t0bb4, d3t0bb5, d3t0bc2, d3t0bc3, d3t0bc4, d3t0bc5, d3t0bd2, d3t0bd3, d3t0bd4, d3t0bd5
    automated match to d1f49a3
    complexed with dms, ipt, mg, na

Details for d3t0bc1

PDB Entry: 3t0b (more details), 2.4 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796t) iptg complex
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3t0bc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t0bc1 b.18.1.0 (C:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3t0bc1:

Click to download the PDB-style file with coordinates for d3t0bc1.
(The format of our PDB-style files is described here.)

Timeline for d3t0bc1: