Lineage for d1tiif_ (1tii F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788379Protein Heat-labile toxin [50205] (2 species)
  7. 2788531Species Escherichia coli, type IIB [TaxId:562] [50207] (4 PDB entries)
  8. 2788541Domain d1tiif_: 1tii F: [24967]
    Other proteins in same PDB: d1tii.1

Details for d1tiif_

PDB Entry: 1tii (more details), 2.25 Å

PDB Description: escherichia coli heat labile enterotoxin type iib
PDB Compounds: (F:) heat labile enterotoxin type iib

SCOPe Domain Sequences for d1tiif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tiif_ b.40.2.1 (F:) Heat-labile toxin {Escherichia coli, type IIB [TaxId: 562]}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlsgmrvnmcaspasspnviwaielea

SCOPe Domain Coordinates for d1tiif_:

Click to download the PDB-style file with coordinates for d1tiif_.
(The format of our PDB-style files is described here.)

Timeline for d1tiif_: