SCOPe 2.06: Domain d1tiie_: 1tii E:

Lineage for d1tiie_ (1tii E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Heat-labile toxin [50205] (2 species)

7. Species Escherichia coli, type IIB [TaxId:562] [50207] (4 PDB entries)

8. Domain d1tiie_: 1tii E: [24966]
   Other proteins in same PDB: d1tii.1

Details for d1tiie_

PDB Entry: 1tii, 2.25 Å

PDB Description: escherichia coli heat labile enterotoxin type iib

PDB Compounds: (E:) heat labile enterotoxin type iib

SCOPe Domain Sequences for d1tiie_:

Sequence; same for both SEQRES and ATOM records:

>d1tiie_ b.40.2.1 (E:) Heat-labile toxin {Escherichia coli, type IIB [TaxId: 562]}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlsgmrvnmcaspasspnviwaielea

Timeline for d1tiie_:

• d1tiie_ first appeared (with stable ids) in SCOP 1.55
  
• d1tiie_ appears in SCOPe 2.05
  
• d1tiie_ appears in SCOPe 2.07
  
• d1tiie_ appears in the current release, SCOPe 2.08