Lineage for d1tiie_ (1tii E:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) 
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) 
Protein Heat-labile toxin [50205] (2 species) 
Species Escherichia coli, type IIB [TaxId:562] [50207] (1 PDB entry) 
Domain d1tiie_: 1tii E: [24966]
Other proteins in same PDB: d1tii.1
Details for d1tiie_
PDB Entry: 1tii (more details), 2.25 Å
PDB Description: escherichia coli heat labile enterotoxin type iib
SCOP Domain Sequences for d1tiie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tiie_ b.40.2.1 (E:) Heat-labile toxin {Escherichia coli, type IIB}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlsgmrvnmcaspasspnviwaielea
SCOP Domain Coordinates for d1tiie_:
Click to download the PDB-style file with coordinates for d1tiie_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tiie_:
- d1tiie_ appears in SCOP 1.57
- d1tiie_ appears in the current release, SCOPe 2.08
View in 3D
