Lineage for d3t0ad2 (3t0a D:220-333)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768157Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1768616Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 1768617Protein automated matches [254633] (7 species)
    not a true protein
  7. 1768697Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries)
  8. 1768728Domain d3t0ad2: 3t0a D:220-333 [249656]
    Other proteins in same PDB: d3t0aa1, d3t0aa3, d3t0aa5, d3t0ab1, d3t0ab3, d3t0ab5, d3t0ac1, d3t0ac3, d3t0ac5, d3t0ad1, d3t0ad3, d3t0ad5
    automated match to d1jz8a1
    complexed with dms, mg, na

Details for d3t0ad2

PDB Entry: 3t0a (more details), 1.9 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796t)
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3t0ad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t0ad2 b.1.4.0 (D:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d3t0ad2:

Click to download the PDB-style file with coordinates for d3t0ad2.
(The format of our PDB-style files is described here.)

Timeline for d3t0ad2: