Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (60 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
Domain d3t09d3: 3t09 D:334-625 [249637] Other proteins in same PDB: d3t09a1, d3t09a2, d3t09a4, d3t09a5, d3t09b1, d3t09b2, d3t09b4, d3t09b5, d3t09c1, d3t09c2, d3t09c4, d3t09c5, d3t09d1, d3t09d2, d3t09d4, d3t09d5 automated match to d1jz7a5 complexed with 149, dms, mg, na |
PDB Entry: 3t09 (more details), 1.75 Å
SCOPe Domain Sequences for d3t09d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t09d3 c.1.8.0 (D:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3t09d3:
View in 3D Domains from same chain: (mouse over for more information) d3t09d1, d3t09d2, d3t09d4, d3t09d5 |