Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (24 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
Domain d3t09c1: 3t09 C:9-219 [249630] Other proteins in same PDB: d3t09a2, d3t09a3, d3t09a4, d3t09a5, d3t09b2, d3t09b3, d3t09b4, d3t09b5, d3t09c2, d3t09c3, d3t09c4, d3t09c5, d3t09d2, d3t09d3, d3t09d4, d3t09d5 automated match to d1f49a3 complexed with 149, dms, mg, na |
PDB Entry: 3t09 (more details), 1.75 Å
SCOPe Domain Sequences for d3t09c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t09c1 b.18.1.0 (C:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]} vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3t09c1:
View in 3D Domains from same chain: (mouse over for more information) d3t09c2, d3t09c3, d3t09c4, d3t09c5 |