Lineage for d3t09c1 (3t09 C:9-219)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530952Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1530953Protein automated matches [190770] (24 species)
    not a true protein
  7. 1531010Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 1531029Domain d3t09c1: 3t09 C:9-219 [249630]
    Other proteins in same PDB: d3t09a2, d3t09a3, d3t09a4, d3t09a5, d3t09b2, d3t09b3, d3t09b4, d3t09b5, d3t09c2, d3t09c3, d3t09c4, d3t09c5, d3t09d2, d3t09d3, d3t09d4, d3t09d5
    automated match to d1f49a3
    complexed with 149, dms, mg, na

Details for d3t09c1

PDB Entry: 3t09 (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796a) galactonolactone complex
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3t09c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t09c1 b.18.1.0 (C:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3t09c1:

Click to download the PDB-style file with coordinates for d3t09c1.
(The format of our PDB-style files is described here.)

Timeline for d3t09c1: