Lineage for d3szkf_ (3szk F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1525010Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 1525011Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 1525030Protein automated matches [191246] (3 species)
    not a true protein
  7. 1525044Species Staphylococcus aureus [TaxId:196620] [255324] (2 PDB entries)
  8. 1525046Domain d3szkf_: 3szk F: [249599]
    Other proteins in same PDB: d3szka_, d3szkb_, d3szkd_, d3szke_
    automated match to d3ovub_
    complexed with hem

Details for d3szkf_

PDB Entry: 3szk (more details), 3.01 Å

PDB Description: Crystal Structure of Human metHaemoglobin Complexed with the First NEAT Domain of IsdH from Staphylococcus aureus
PDB Compounds: (F:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d3szkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3szkf_ b.1.28.1 (F:) automated matches {Staphylococcus aureus [TaxId: 196620]}
slkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkkaevel
dintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstqiddge
etnydytklvfakpiyndpsl

SCOPe Domain Coordinates for d3szkf_:

Click to download the PDB-style file with coordinates for d3szkf_.
(The format of our PDB-style files is described here.)

Timeline for d3szkf_: