Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Helicobacter pylori [TaxId:563041] [256091] (2 PDB entries) |
Domain d3sxpa_: 3sxp A: [249589] automated match to d4glla_ complexed with nad |
PDB Entry: 3sxp (more details), 2.55 Å
SCOPe Domain Sequences for d3sxpa_:
Sequence, based on SEQRES records: (download)
>d3sxpa_ c.2.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 563041]} mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsntlfsnnrpsslg hfknligfkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqafl nlleiarskkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnv qvglryfnvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanv kamkaqksgvynvgysqarsyneivsilkehlgdfkvtyiknpyaffqkhtqahieptil dldytplydlesgikdylphihai
>d3sxpa_ c.2.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 563041]} mryiddelenqtilitggagfvgsnlafhfqenhpkakvvvldkfrsnpsslghfknlig fkgeviaadinnpldlrrleklhfdylfhqaavsdttmlnqelvmktnyqaflnlleiar skkakviyassagvygntkapnvvgknespenvygfsklcmdefvlshsndnvqvglryf nvygprefykektasmvlqlalgamafkevklfefgeqlrdfvyiedviqanvkamkaqk sgvynvgysqarsyneivsilkehlgdfkvtyikkhtqahieptildldytplydlesgi kdylphihai
Timeline for d3sxpa_:
View in 3D Domains from other chains: (mouse over for more information) d3sxpb_, d3sxpc_, d3sxpd_, d3sxpe_ |