SCOPe 2.08: Domain d3sqjb2: 3sqj B:197-388

Lineage for d3sqjb2 (3sqj B:197-388)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries)

8. Domain d3sqjb2: 3sqj B:197-388 [249568]
   automated match to d4l8ua2
   complexed with myr

Details for d3sqjb2

PDB Entry: 3sqj, 2.05 Å

PDB Description: Recombinant human serum albumin from transgenic plant

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d3sqjb2:

Sequence; same for both SEQRES and ATOM records:

>d3sqjb2 a.126.1.0 (B:197-388) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

Timeline for d3sqjb2:

• d3sqjb2 first appeared in SCOPe 2.04
  
• d3sqjb2 appears in SCOPe 2.07