Lineage for d3sm5m1 (3sm5 M:2-108)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766330Domain d3sm5m1: 3sm5 M:2-108 [249505]
    Other proteins in same PDB: d3sm5a_, d3sm5b_, d3sm5c_, d3sm5d_, d3sm5e_, d3sm5f_
    automated match to d4m1dl1
    complexed with man, nag, so4

Details for d3sm5m1

PDB Entry: 3sm5 (more details), 3.19 Å

PDB Description: influenza hemagglutinin in complex with a neutralizing antibody
PDB Compounds: (M:) CH65, light chain, Fab fragment

SCOPe Domain Sequences for d3sm5m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sm5m1 b.1.1.0 (M:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsvapgqtaritcggndigrksvhwnqqkpgqapvlvvcydsdrpsgiperf
sgsnsgntatltisrveagdeadyycqvwdsssdhvifgggtkltvl

SCOPe Domain Coordinates for d3sm5m1:

Click to download the PDB-style file with coordinates for d3sm5m1.
(The format of our PDB-style files is described here.)

Timeline for d3sm5m1: