Lineage for d3sm5f_ (3sm5 F:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267255Domain d3sm5f_: 3sm5 F: [249502]
    Other proteins in same PDB: d3sm5a1, d3sm5a2, d3sm5c1, d3sm5c2, d3sm5e1, d3sm5e2, d3sm5l1, d3sm5l2, d3sm5m1, d3sm5m2, d3sm5n1, d3sm5n2
    automated match to d4n5zb_
    complexed with man, nag, so4

Details for d3sm5f_

PDB Entry: 3sm5 (more details), 3.19 Å

PDB Description: influenza hemagglutinin in complex with a neutralizing antibody
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d3sm5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sm5f_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnreki

SCOPe Domain Coordinates for d3sm5f_:

Click to download the PDB-style file with coordinates for d3sm5f_.
(The format of our PDB-style files is described here.)

Timeline for d3sm5f_: