Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (7 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries) |
Domain d3sm5c_: 3sm5 C: [249499] Other proteins in same PDB: d3sm5b_, d3sm5d_, d3sm5f_, d3sm5l1, d3sm5l2, d3sm5m1, d3sm5m2, d3sm5n1, d3sm5n2 automated match to d1rd8a_ complexed with man, nag, so4 |
PDB Entry: 3sm5 (more details), 3.19 Å
SCOPe Domain Sequences for d3sm5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sm5c_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} edticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvag wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh hppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdti ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti gecpkyvrsaklrmvtglrnips
Timeline for d3sm5c_: