Lineage for d3sm5c_ (3sm5 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778416Domain d3sm5c_: 3sm5 C: [249499]
    Other proteins in same PDB: d3sm5b_, d3sm5d_, d3sm5f_, d3sm5l1, d3sm5l2, d3sm5m1, d3sm5m2, d3sm5n1, d3sm5n2
    automated match to d1rd8a_
    complexed with man, nag, so4

Details for d3sm5c_

PDB Entry: 3sm5 (more details), 3.19 Å

PDB Description: influenza hemagglutinin in complex with a neutralizing antibody
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d3sm5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sm5c_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
edticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvag
wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk
esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh
hppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdti
ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti
gecpkyvrsaklrmvtglrnips

SCOPe Domain Coordinates for d3sm5c_:

Click to download the PDB-style file with coordinates for d3sm5c_.
(The format of our PDB-style files is described here.)

Timeline for d3sm5c_: