Lineage for d3sm5a_ (3sm5 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531229Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1531245Species Influenza A virus, different strains [TaxId:11320] [49825] (99 PDB entries)
  8. 1531497Domain d3sm5a_: 3sm5 A: [249497]
    Other proteins in same PDB: d3sm5b_, d3sm5d_, d3sm5f_, d3sm5l1, d3sm5l2, d3sm5m1, d3sm5m2, d3sm5n1, d3sm5n2
    automated match to d1rd8a_
    complexed with man, nag, so4

Details for d3sm5a_

PDB Entry: 3sm5 (more details), 3.19 Å

PDB Description: influenza hemagglutinin in complex with a neutralizing antibody
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d3sm5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sm5a_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
edticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvag
wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk
esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh
hppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdti
ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti
gecpkyvrsaklrmvtglrnips

SCOPe Domain Coordinates for d3sm5a_:

Click to download the PDB-style file with coordinates for d3sm5a_.
(The format of our PDB-style files is described here.)

Timeline for d3sm5a_: