Lineage for d3sjza3 (3sjz A:321-415)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544753Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544754Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1544858Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 1544859Protein automated matches [254425] (11 species)
    not a true protein
  7. 1544894Species Sulfolobus solfataricus [TaxId:273057] [256085] (1 PDB entry)
  8. 1544895Domain d3sjza3: 3sjz A:321-415 [249490]
    Other proteins in same PDB: d3sjza1, d3sjza2
    automated match to d2qn6a2
    protein/RNA complex; complexed with bme, gdp, gnp

Details for d3sjza3

PDB Entry: 3sjz (more details), 2.8 Å

PDB Description: The structure of aIF2gamma subunit delta 41-45 from archaeon Sulfolobus solfataricus complexed with GDP and GDPNP
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d3sjza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sjza3 b.44.1.0 (A:321-415) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d3sjza3:

Click to download the PDB-style file with coordinates for d3sjza3.
(The format of our PDB-style files is described here.)

Timeline for d3sjza3: