Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (29 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:273057] [256083] (12 PDB entries) |
Domain d3sjza1: 3sjz A:2-206 [249488] Other proteins in same PDB: d3sjza2, d3sjza3 automated match to d2qn6a3 protein/RNA complex; complexed with bme, gdp, gnp |
PDB Entry: 3sjz (more details), 2.8 Å
SCOPe Domain Sequences for d3sjza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sjza1 c.37.1.8 (A:2-206) automated matches {Sulfolobus solfataricus [TaxId: 273057]} awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseetiklgyaetnigvcesckkpe ayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpq pqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsal hkinidsliegieeyiktpy
Timeline for d3sjza1: