SCOPe 2.08: Domain d3sh1j1: 3sh1 J:1-208

Lineage for d3sh1j1 (3sh1 J:1-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d3sh1j1: 3sh1 J:1-208 [249449]
   Other proteins in same PDB: d3sh1a2, d3sh1b2, d3sh1c2, d3sh1d2, d3sh1e2, d3sh1f2, d3sh1g2, d3sh1h2, d3sh1i2, d3sh1j2
   automated match to d2ymea_
   complexed with act, mg, mlk, mpd, mrd, nag

Details for d3sh1j1

PDB Entry: 3sh1, 2.9 Å

PDB Description: ac-achbp ligand binding domain mutated to human alpha-7 nachr

PDB Compounds: (J:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3sh1j1:

Sequence; same for both SEQRES and ATOM records:

>d3sh1j1 b.96.1.0 (J:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvylsfslldivkadsstnevdlvyweqqsw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqnalvnssghvqylpa
qrlsfmcdptgvdseegatcavkfgswsyggweidlktdtdqvdlssyyasskyeilsat
qtrserfyecckepypdvnlvvkfrerr

Timeline for d3sh1j1:

• d3sh1j1 first appeared in SCOPe 2.04, called d3sh1j_
  
• d3sh1j1 appears in SCOPe 2.07