Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries) |
Domain d3sh1j1: 3sh1 J:1-208 [249449] Other proteins in same PDB: d3sh1a2, d3sh1b2, d3sh1c2, d3sh1d2, d3sh1e2, d3sh1f2, d3sh1g2, d3sh1h2, d3sh1i2, d3sh1j2 automated match to d2ymea_ complexed with act, mg, mlk, mpd, mrd, nag |
PDB Entry: 3sh1 (more details), 2.9 Å
SCOPe Domain Sequences for d3sh1j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sh1j1 b.96.1.0 (J:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvylsfslldivkadsstnevdlvyweqqsw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqnalvnssghvqylpa qrlsfmcdptgvdseegatcavkfgswsyggweidlktdtdqvdlssyyasskyeilsat qtrserfyecckepypdvnlvvkfrerr
Timeline for d3sh1j1: