Lineage for d3se6b1 (3se6 B:55-271)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2085522Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2085523Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2085607Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2085608Protein automated matches [254706] (5 species)
    not a true protein
  7. 2085612Species Human (Homo sapiens) [TaxId:9606] [255964] (18 PDB entries)
  8. 2085629Domain d3se6b1: 3se6 B:55-271 [249389]
    Other proteins in same PDB: d3se6a2, d3se6a3, d3se6a4, d3se6a5, d3se6b2, d3se6b3, d3se6b4, d3se6b5
    automated match to d2yd0a1
    complexed with lys, mes, nag, zn

Details for d3se6b1

PDB Entry: 3se6 (more details), 3.08 Å

PDB Description: crystal structure of the human endoplasmic reticulum aminopeptidase 2
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d3se6b1:

Sequence, based on SEQRES records: (download)

>d3se6b1 b.98.1.0 (B:55-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskd
leitnatlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgd
gfegfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhials
nmpkvktielegglledhfettvkmstylvayivcdf

Sequence, based on observed residues (ATOM records): (download)

>d3se6b1 b.98.1.0 (B:55-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskd
leitnatlqsepgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgfegfyk
styrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnmpkvkt
ielegglledhfettvkmstylvayivcdf

SCOPe Domain Coordinates for d3se6b1:

Click to download the PDB-style file with coordinates for d3se6b1.
(The format of our PDB-style files is described here.)

Timeline for d3se6b1: