Class b: All beta proteins [48724] (177 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255964] (18 PDB entries) |
Domain d3se6b1: 3se6 B:55-271 [249389] Other proteins in same PDB: d3se6a2, d3se6a3, d3se6a4, d3se6a5, d3se6b2, d3se6b3, d3se6b4, d3se6b5 automated match to d2yd0a1 complexed with lys, mes, nag, zn |
PDB Entry: 3se6 (more details), 3.08 Å
SCOPe Domain Sequences for d3se6b1:
Sequence, based on SEQRES records: (download)
>d3se6b1 b.98.1.0 (B:55-271) automated matches {Human (Homo sapiens) [TaxId: 9606]} vatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskd leitnatlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgd gfegfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhials nmpkvktielegglledhfettvkmstylvayivcdf
>d3se6b1 b.98.1.0 (B:55-271) automated matches {Human (Homo sapiens) [TaxId: 9606]} vatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskd leitnatlqsepgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgfegfyk styrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnmpkvkt ielegglledhfettvkmstylvayivcdf
Timeline for d3se6b1: