SCOPe 2.04: Domain d3sdxh2: 3sdx H:119-247

Lineage for d3sdxh2 (3sdx H:119-247)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3sdxh2: 3sdx H:119-247 [249384]
   Other proteins in same PDB: d3sdxa1, d3sdxb_, d3sdxc1, d3sdxd_, d3sdxe2, d3sdxg2
   automated match to d2nw2b2
   complexed with gcy

Details for d3sdxh2

PDB Entry: 3sdx, 3.12 Å

PDB Description: Crystal structure of human autoreactive-Valpha24 NKT TCR in complex with CD1d-beta-galactosylceramide

PDB Compounds: (H:) NKT TCR autoreactive-Vbeta11 chain

SCOPe Domain Sequences for d3sdxh2:

Sequence; same for both SEQRES and ATOM records:

>d3sdxh2 b.1.1.0 (H:119-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d3sdxh2:

• d3sdxh2 is new in SCOPe 2.04-stable
  
• d3sdxh2 appears in SCOPe 2.05
  
• d3sdxh2 appears in the current release, SCOPe 2.08