SCOPe 2.04: Domain d3sdxe2: 3sdx E:115-203

Lineage for d3sdxe2 (3sdx E:115-203)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d3sdxe2: 3sdx E:115-203 [249378]
   Other proteins in same PDB: d3sdxa1, d3sdxa2, d3sdxb_, d3sdxc1, d3sdxc2, d3sdxd_, d3sdxe1, d3sdxf1, d3sdxf2, d3sdxg1, d3sdxh1, d3sdxh2
   automated match to d4eura2
   complexed with gcy

Details for d3sdxe2

PDB Entry: 3sdx, 3.12 Å

PDB Description: Crystal structure of human autoreactive-Valpha24 NKT TCR in complex with CD1d-beta-galactosylceramide

PDB Compounds: (E:) NKT TCR Valpha24 chain

SCOPe Domain Sequences for d3sdxe2:

Sequence, based on SEQRES records:

>d3sdxe2 b.1.1.2 (E:115-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d3sdxe2 b.1.1.2 (E:115-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdssvclftdfdsqtnvsqssdvyitdkcvldmrsmdfksnsavawsnk
sdfacanafnnsiipedtffps

Timeline for d3sdxe2:

• d3sdxe2 is new in SCOPe 2.04-stable
  
• d3sdxe2 appears in SCOPe 2.05
  
• d3sdxe2 appears in the current release, SCOPe 2.08