SCOPe 2.05: Domain d3sdxc1: 3sdx C:6-183

Lineage for d3sdxc1 (3sdx C:6-183)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (11 PDB entries)

8. Domain d3sdxc1: 3sdx C:6-183 [249374]
   Other proteins in same PDB: d3sdxa2, d3sdxb_, d3sdxc2, d3sdxd_, d3sdxe1, d3sdxe2, d3sdxf1, d3sdxf2, d3sdxg1, d3sdxg2, d3sdxh1, d3sdxh2
   automated match to d3hujc1
   complexed with gcy

Details for d3sdxc1

PDB Entry: 3sdx, 3.12 Å

PDB Description: Crystal structure of human autoreactive-Valpha24 NKT TCR in complex with CD1d-beta-galactosylceramide

PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3sdxc1:

Sequence; same for both SEQRES and ATOM records:

>d3sdxc1 d.19.1.1 (C:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils
fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

Timeline for d3sdxc1:

• d3sdxc1 first appeared in SCOPe 2.04
  
• d3sdxc1 appears in SCOPe 2.06
  
• d3sdxc1 appears in the current release, SCOPe 2.08