Lineage for d3sdxa2 (3sdx A:184-280)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766320Domain d3sdxa2: 3sdx A:184-280 [249372]
    Other proteins in same PDB: d3sdxa1, d3sdxb_, d3sdxc1, d3sdxd_, d3sdxe2, d3sdxg2
    automated match to d3hujc2
    complexed with gcy

Details for d3sdxa2

PDB Entry: 3sdx (more details), 3.12 Å

PDB Description: Crystal structure of human autoreactive-Valpha24 NKT TCR in complex with CD1d-beta-galactosylceramide
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3sdxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdxa2 b.1.1.0 (A:184-280) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlywhhh

SCOPe Domain Coordinates for d3sdxa2:

Click to download the PDB-style file with coordinates for d3sdxa2.
(The format of our PDB-style files is described here.)

Timeline for d3sdxa2: