Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d3sddd2: 3sdd D:120-242 [249368] Other proteins in same PDB: d3sdda1, d3sdda2, d3sdda3, d3sddb_, d3sddc1, d3sddd1 automated match to d3of6b2 complexed with 3gd, nag |
PDB Entry: 3sdd (more details), 3 Å
SCOPe Domain Sequences for d3sddd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sddd2 b.1.1.2 (D:120-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aea
Timeline for d3sddd2: