Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (33 PDB entries) |
Domain d3sdda1: 3sdd A:6-185 [249362] Other proteins in same PDB: d3sdda2, d3sdda3, d3sddb_, d3sddc1, d3sddc2, d3sddd1, d3sddd2 automated match to d4f7ca1 complexed with 3gd, nag |
PDB Entry: 3sdd (more details), 3 Å
SCOPe Domain Sequences for d3sdda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sdda1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3sdda1: