Lineage for d3sdcd1 (3sdc D:1-119)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035326Domain d3sdcd1: 3sdc D:1-119 [249360]
    Other proteins in same PDB: d3sdca1, d3sdca3, d3sdcb_, d3sdcc2, d3sdcd2
    automated match to d3of6c1
    complexed with 3gb, nag

Details for d3sdcd1

PDB Entry: 3sdc (more details), 3.1 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
PDB Compounds: (D:) NKT TCR autoreactive-Vbeta6 chain

SCOPe Domain Sequences for d3sdcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdcd1 b.1.1.0 (D:1-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ggiitqtpkfligqegqkltlkcqqnfnhdtmywyrqdsgkglrliyysygagstekgdl
segydasrekkssfsltvtsaqknemavflcasgslldvrevffgkgtrltvved

SCOPe Domain Coordinates for d3sdcd1:

Click to download the PDB-style file with coordinates for d3sdcd1.
(The format of our PDB-style files is described here.)

Timeline for d3sdcd1: