SCOPe 2.05: Domain d3sdcc2: 3sdc C:118-204

Lineage for d3sdcc2 (3sdc C:118-204)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d3sdcc2: 3sdc C:118-204 [249359]
   Other proteins in same PDB: d3sdca1, d3sdca2, d3sdcb_, d3sdcc1, d3sdcd1
   automated match to d4eura2
   complexed with 3gb, nag

Details for d3sdcc2

PDB Entry: 3sdc, 3.1 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide

PDB Compounds: (C:) NKT TCR Valpha14 chain

SCOPe Domain Sequences for d3sdcc2:

Sequence, based on SEQRES records:

>d3sdcc2 b.1.1.2 (C:118-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtff

Sequence, based on observed residues (ATOM records):

>d3sdcc2 b.1.1.2 (C:118-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
wsacanafnnipedtff

Timeline for d3sdcc2:

• d3sdcc2 first appeared in SCOPe 2.04
  
• d3sdcc2 appears in SCOPe 2.06
  
• d3sdcc2 appears in the current release, SCOPe 2.08