Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d3sdca2: 3sdc A:186-279 [249356] Other proteins in same PDB: d3sdca1, d3sdca3, d3sdcb_, d3sdcc2, d3sdcd2 automated match to d4f7ca2 complexed with 3gb, nag |
PDB Entry: 3sdc (more details), 3.1 Å
SCOPe Domain Sequences for d3sdca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sdca2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
Timeline for d3sdca2: