Lineage for d3sdca1 (3sdc A:7-185)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2183623Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2183624Protein automated matches [226842] (4 species)
    not a true protein
  7. 2183780Species Mouse (Mus musculus) [TaxId:10090] [224924] (33 PDB entries)
  8. 2183820Domain d3sdca1: 3sdc A:7-185 [249355]
    Other proteins in same PDB: d3sdca2, d3sdca3, d3sdcb_, d3sdcc1, d3sdcc2, d3sdcd1, d3sdcd2
    automated match to d4f7ca1
    complexed with 3gb, nag

Details for d3sdca1

PDB Entry: 3sdc (more details), 3.1 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3sdca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdca1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3sdca1:

Click to download the PDB-style file with coordinates for d3sdca1.
(The format of our PDB-style files is described here.)

Timeline for d3sdca1: