Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.28: NEAT domain-like [158911] (2 families) |
Family b.1.28.1: NEAT domain [158912] (4 proteins) Pfam PF05031; iron transport-associated domain |
Protein automated matches [191246] (3 species) not a true protein |
Species Staphylococcus aureus [TaxId:282459] [226200] (2 PDB entries) |
Domain d3s48a_: 3s48 A: [249295] Other proteins in same PDB: d3s48c_, d3s48d_ automated match to d3ovub_ complexed with hem |
PDB Entry: 3s48 (more details), 3.05 Å
SCOPe Domain Sequences for d3s48a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s48a_ b.1.28.1 (A:) automated matches {Staphylococcus aureus [TaxId: 282459]} deslkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkkaev eldintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstqidd geetnydytklvfakpiyndpsl
Timeline for d3s48a_: