Class b: All beta proteins [48724] (119 folds) |
Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
Protein Heat-labile toxin [50205] (2 species) |
Species Escherichia coli, type IB [TaxId:562] [50206] (18 PDB entries) |
Domain d1ltih_: 1lti H: [24924] Other proteins in same PDB: d1lti.1 complexed with gal, nga |
PDB Entry: 1lti (more details), 2.13 Å
SCOP Domain Sequences for d1ltih_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ltih_ b.40.2.1 (H:) Heat-labile toxin {Escherichia coli, type IB} apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
Timeline for d1ltih_: