Lineage for d1ltih_ (1lti H:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228614Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 228677Protein Heat-labile toxin [50205] (2 species)
  7. 228678Species Escherichia coli, type IB [TaxId:562] [50206] (18 PDB entries)
  8. 228738Domain d1ltih_: 1lti H: [24924]
    Other proteins in same PDB: d1lti.1
    complexed with gal, nga

Details for d1ltih_

PDB Entry: 1lti (more details), 2.13 Å

PDB Description: heat-labile enterotoxin (lt-i) complex with t-antigen

SCOP Domain Sequences for d1ltih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltih_ b.40.2.1 (H:) Heat-labile toxin {Escherichia coli, type IB}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOP Domain Coordinates for d1ltih_:

Click to download the PDB-style file with coordinates for d1ltih_.
(The format of our PDB-style files is described here.)

Timeline for d1ltih_: