SCOPe 2.06: Domain d3rw7a2: 3rw7 A:203-362

Lineage for d3rw7a2 (3rw7 A:203-362)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.3: mRNA export factor tap [52065] (2 proteins)
   this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain

6. Protein automated matches [254723] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256067] (1 PDB entry)

8. Domain d3rw7a2: 3rw7 A:203-362 [249239]
   Other proteins in same PDB: d3rw7a1, d3rw7c1
   automated match to d1kooa1

Details for d3rw7a2

PDB Entry: 3rw7, 3 Å

PDB Description: Structure of N-terminal domain of nuclear RNA export factor TAP

PDB Compounds: (A:) nuclear RNA export factor 1

SCOPe Domain Sequences for d3rw7a2:

Sequence; same for both SEQRES and ATOM records:

>d3rw7a2 c.10.2.3 (A:203-362) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlriiee
nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl
dgnslcdtfrdqstyisairerfpkllrldghelpppiaf

Timeline for d3rw7a2:

• d3rw7a2 first appeared in SCOPe 2.04
  
• d3rw7a2 appears in SCOPe 2.05
  
• d3rw7a2 appears in SCOPe 2.07
  
• d3rw7a2 appears in the current release, SCOPe 2.08