SCOPe 2.06: Domain d3rw7a1: 3rw7 A:118-199

Lineage for d3rw7a1 (3rw7 A:118-199)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)

8. Domain d3rw7a1: 3rw7 A:118-199 [249238]
   Other proteins in same PDB: d3rw7a2, d3rw7b_, d3rw7c2, d3rw7d_
   automated match to d1kooa2

Details for d3rw7a1

PDB Entry: 3rw7, 3 Å

PDB Description: Structure of N-terminal domain of nuclear RNA export factor TAP

PDB Compounds: (A:) nuclear RNA export factor 1

SCOPe Domain Sequences for d3rw7a1:

Sequence; same for both SEQRES and ATOM records:

>d3rw7a1 d.58.7.0 (A:118-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavny
kildrenrrisiiinssappht

Timeline for d3rw7a1:

• d3rw7a1 first appeared in SCOPe 2.04
  
• d3rw7a1 appears in SCOPe 2.05
  
• d3rw7a1 appears in SCOPe 2.07
  
• d3rw7a1 appears in the current release, SCOPe 2.08