Lineage for d3rrua_ (3rru A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727055Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2727164Family a.118.9.0: automated matches [191620] (1 protein)
    not a true family
  6. 2727165Protein automated matches [191137] (5 species)
    not a true protein
  7. 2727176Species Human (Homo sapiens) [TaxId:9606] [189251] (7 PDB entries)
  8. 2727184Domain d3rrua_: 3rru A: [249201]
    automated match to d1elka_

Details for d3rrua_

PDB Entry: 3rru (more details), 3 Å

PDB Description: x-ray crystal structure of the vhs domain of human tom1-like protein, northeast structural genomics consortium target hr3050e
PDB Compounds: (A:) TOM1L1 protein

SCOPe Domain Sequences for d3rrua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rrua_ a.118.9.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpyatsvghliekatfagvqtedwgqfmhicdiinttqdgpkdavkalkkrisknynhke
iqltlslidmcvqncgpsfqslivkkefvkenlvkllnprynlpldiqnrilnfiktwsq
gfpggvdvsevkevyldlvkk

SCOPe Domain Coordinates for d3rrua_:

Click to download the PDB-style file with coordinates for d3rrua_.
(The format of our PDB-style files is described here.)

Timeline for d3rrua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3rrub_