SCOPe 2.04: Domain d3rmyd1: 3rmy D:862-1067

Lineage for d3rmyd1 (3rmy D:862-1067)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (29 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [225675] (19 PDB entries)

8. Domain d3rmyd1: 3rmy D:862-1067 [249186]
   Other proteins in same PDB: d3rmya2, d3rmyb2, d3rmyc2, d3rmyd2
   automated match to d3pmea1
   complexed with gol; mutant

Details for d3rmyd1

PDB Entry: 3rmy, 2.3 Å

PDB Description: crystal structure of hcr/d w1238a mutant

PDB Compounds: (D:) Botulinum neurotoxin type D

SCOPe Domain Sequences for d3rmyd1:

Sequence, based on SEQRES records:

>d3rmyd1 b.29.1.0 (D:862-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn
ilysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrk
ykslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldkti
vfgidenidenqmlwirdfnifskel

Sequence, based on observed residues (ATOM records):

>d3rmyd1 b.29.1.0 (D:862-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn
ienssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrkykslif
dyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktivfgide
nidenqmlwirdfnifskel

Timeline for d3rmyd1:

• d3rmyd1 is new in SCOPe 2.04-stable
  
• d3rmyd1 appears in SCOPe 2.05
  
• d3rmyd1 appears in the current release, SCOPe 2.08