Lineage for d3rmyc2 (3rmy C:1068-1276)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543707Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 1543817Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 1543818Protein automated matches [190445] (5 species)
    not a true protein
  7. 1543823Species Clostridium botulinum [TaxId:1491] [225676] (19 PDB entries)
  8. 1543843Domain d3rmyc2: 3rmy C:1068-1276 [249185]
    Other proteins in same PDB: d3rmya1, d3rmyb1, d3rmyc1, d3rmyd1
    automated match to d3pmea2
    complexed with gol; mutant

Details for d3rmyc2

PDB Entry: 3rmy (more details), 2.3 Å

PDB Description: crystal structure of hcr/d w1238a mutant
PDB Compounds: (C:) Botulinum neurotoxin type D

SCOPe Domain Sequences for d3rmyc2:

Sequence, based on SEQRES records: (download)

>d3rmyc2 b.42.4.0 (C:1068-1276) automated matches {Clostridium botulinum [TaxId: 1491]}
snedinivyegqilrnvikdywgnplkfdteyyiindnyidryiapesnvlvlvqypdrs
klytgnpitiksvsdknpysrilngdniilhmlynsrkymiirdtdtiyatqggecsqnc
vyalklqsnlgnygigifsiknivsknkycsqifssfrentmlladiykparfsfknayt
pvavtnyetkllstssfwkfisrdpgwve

Sequence, based on observed residues (ATOM records): (download)

>d3rmyc2 b.42.4.0 (C:1068-1276) automated matches {Clostridium botulinum [TaxId: 1491]}
snedinivyegqilrnvikdywgnplkfdteyyiindnyidryiapesnvlvlvqypdrs
klytgnpitiksvsdknpysrilngdniilhmlynsrkymiirdtdtiyacsqncvyalk
lqsnlgnygigifsiknivsknkycsqifssfrentmlladiykparfsfknaytpvavt
nyetkllstssfwkfisrdpgwve

SCOPe Domain Coordinates for d3rmyc2:

Click to download the PDB-style file with coordinates for d3rmyc2.
(The format of our PDB-style files is described here.)

Timeline for d3rmyc2: