Lineage for d3rmxb1 (3rmx B:862-1067)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781886Species Clostridium botulinum [TaxId:1491] [225675] (21 PDB entries)
  8. 1781916Domain d3rmxb1: 3rmx B:862-1067 [249174]
    Other proteins in same PDB: d3rmxa2, d3rmxb2, d3rmxc2, d3rmxd2
    automated match to d3pmea1
    mutant

Details for d3rmxb1

PDB Entry: 3rmx (more details), 2.75 Å

PDB Description: Crystal structure of HCR/D F1240A mutant
PDB Compounds: (B:) Botulinum neurotoxin type D

SCOPe Domain Sequences for d3rmxb1:

Sequence, based on SEQRES records: (download)

>d3rmxb1 b.29.1.0 (B:862-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn
ilysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrk
ykslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldkti
vfgidenidenqmlwirdfnifskel

Sequence, based on observed residues (ATOM records): (download)

>d3rmxb1 b.29.1.0 (B:862-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn
saiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrkyks
lifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktivfg
idenidenqmlwirdfnifskel

SCOPe Domain Coordinates for d3rmxb1:

Click to download the PDB-style file with coordinates for d3rmxb1.
(The format of our PDB-style files is described here.)

Timeline for d3rmxb1: