Lineage for d1ltaf_ (1lta F:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228614Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 228677Protein Heat-labile toxin [50205] (2 species)
  7. 228678Species Escherichia coli, type IB [TaxId:562] [50206] (18 PDB entries)
  8. 228731Domain d1ltaf_: 1lta F: [24917]
    Other proteins in same PDB: d1lta.1

Details for d1ltaf_

PDB Entry: 1lta (more details), 2.2 Å

PDB Description: 2.2 angstroms crystal structure of e. coli heat-labile enterotoxin (lt) with bound galactose

SCOP Domain Sequences for d1ltaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltaf_ b.40.2.1 (F:) Heat-labile toxin {Escherichia coli, type IB}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOP Domain Coordinates for d1ltaf_:

Click to download the PDB-style file with coordinates for d1ltaf_.
(The format of our PDB-style files is described here.)

Timeline for d1ltaf_: