Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (61 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [255519] (12 PDB entries) |
Domain d3rhpa_: 3rhp A: [249112] automated match to d1bxsa_ complexed with gol, so4; mutant |
PDB Entry: 3rhp (more details), 2.5 Å
SCOPe Domain Sequences for d3rhpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rhpa_ c.82.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg enaiaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl geaalneylriktvtfey
Timeline for d3rhpa_: