SCOPe 2.04: Domain d3rhob_: 3rho B:

Lineage for d3rhob_ (3rho B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (35 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255519] (12 PDB entries)

8. Domain d3rhob_: 3rho B: [249109]
   automated match to d1bxsa_
   complexed with gol, nap, so4; mutant

Details for d3rhob_

PDB Entry: 3rho, 2.26 Å

PDB Description: crystal structure of the e673q mutant of c-terminal domain of 10'formyltetrahydrofolate dehydrogenase in complex with nadp

PDB Compounds: (B:) Aldehyde dehydrogenase 1 family, member L1

SCOPe Domain Sequences for d3rhob_:

Sequence; same for both SEQRES and ATOM records:

>d3rhob_ c.82.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
kigftgstevgkhimkscalsnvkkvslqlggkspliifadcdlnkavqmgmssvffnkg
enciaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
geaalneylriktvtfey

Timeline for d3rhob_:

• d3rhob_ is new in SCOPe 2.04-stable
  
• d3rhob_ appears in SCOPe 2.05
  
• d3rhob_ appears in the current release, SCOPe 2.08