Lineage for d3rhld_ (3rhl D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875571Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1875572Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1875981Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 1875982Protein automated matches [190683] (38 species)
    not a true protein
  7. 1876262Species Norway rat (Rattus norvegicus) [TaxId:10116] [255519] (12 PDB entries)
  8. 1876274Domain d3rhld_: 3rhl D: [249103]
    automated match to d1bxsa_
    complexed with gol, nap, so4; mutant

Details for d3rhld_

PDB Entry: 3rhl (more details), 2 Å

PDB Description: crystal structure of the e673a/c707a double mutant of the c-terminal domain of rat 10'formyltetrahydrofolate dehydrogenase in complex with co-purified nadp
PDB Compounds: (D:) Aldehyde dehydrogenase 1 family, member L1

SCOPe Domain Sequences for d3rhld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rhld_ c.82.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
kigftgstevgkhimkscalsnvkkvslalggkspliifadcdlnkavqmgmssvffnkg
enaiaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
geaalneylriktvtfey

SCOPe Domain Coordinates for d3rhld_:

Click to download the PDB-style file with coordinates for d3rhld_.
(The format of our PDB-style files is described here.)

Timeline for d3rhld_: